{"product_id":"proteintech-23525-1-ap","title":"Proteintech, 23525-1-AP, ESCO2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ESCO2 (23525-1-AP) by Proteintech is a Polyclonal antibody targeting ESCO2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n23525-1-AP targets ESCO2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  mouse testis,  rat testis\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nESCO2 is also known as Establishment of Sister Chromatid Cohesion N-Acetyltransferase 2, EFO2. This gene encodes a member of the family of acetyltransferases involved in the establishment of sister chromatid cohesion during S phase and postreplicative sister chromatid cohesion induced by double-strand breaks (PubMed: 15821733). Mutations in the ESCO2 gene are associated with a rare genetic disorder called Roberts syndrome or SC phocomelia syndrome (PubMed: 16380922). The loss of function or impaired activity of the ESCO2 protein due to mutations disrupts the proper cohesion of sister chromatids, leading to chromosomal abnormalities and the characteristic features of Roberts syndrome. ESCO2 can be detected as about 65-70 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18893 Product name: Recombinant human ESCO2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-353 aa of BC146562 Sequence: MAALTPRKRKQDSLKCDSLLHFTENLFPSPNKKHCFYQNSDKNEENLHCSQQEHFVLSALKTTEINRLPSANQGSPFKSALSTVSFYNQNKWYLNPLERKLIKESRSTCLKTNDEDKSFPIVTEKMQGKPVCSKKNNKKPQKSLTAKYQPKYRHIKPVSRNSRNSKQNRVIYKPIVEKENNCHSAENNSNAPRVLSQKIKPQVTLQGGAAFFVRKKSSLRKSSLENEPSLGRTQKSKSEVIEDSDVETVSEKKTFATRQVPKCLVLEEKLKIGLLSASSKNKEKLIKDSSDDRVSSKEHKVDKNEAFSSEDSLGENKTISPKSTVYPIFSASSVNSKRSLGEEQFSVGSVNFM Predict reactive species\nFull Name: establishment of cohesion 1 homolog 2 (S. cerevisiae)\nCalculated Molecular Weight: 601 aa, 68 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC146562\nGene Symbol: ESCO2\nGene ID (NCBI): 157570\nRRID: AB_2879292\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q56NI9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868997505193,"sku":"23525-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23525-1-ap","provider":"Iright","version":"1.0","type":"link"}