{"product_id":"proteintech-23724-1-ap","title":"Proteintech, 23724-1-AP, AIDA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AIDA (23724-1-AP) by Proteintech is a Polyclonal antibody targeting AIDA in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n23724-1-AP targets AIDA in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse skeletal muscle tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAIDA, also named as C1orf80, acts as a ventralizing factor during embryogenesis. It inhibits axin-mediated JNK activation by binding axin and disrupting axin homodimerization. It's highest expression in the heart and skeletal muscle. AIDA has three isoforms with MW 35 kDa, 16 kDa and 26 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20588 Product name: Recombinant human AIDA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-306 aa of BC015535 Sequence: MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRILAPGEEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQTLHKE Predict reactive species\nFull Name: axin interactor, dorsalization associated\nCalculated Molecular Weight: 306 aa, 35 kDa\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: BC015535\nGene Symbol: AIDA\nGene ID (NCBI): 64853\nRRID: AB_2879311\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96BJ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869512749225,"sku":"23724-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23724-1-ap","provider":"Iright","version":"1.0","type":"link"}