{"product_id":"proteintech-23758-1-ap","title":"Proteintech, 23758-1-AP, TPC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TPC1 (23758-1-AP) by Proteintech is a Polyclonal antibody targeting TPC1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n23758-1-AP targets TPC1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, rat heart tissue\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTwo-pore channels (TPCs) are ancient members of the voltage-gated ion channel superfamily, are thought to be non-selective cation channels permeable to Ca2+. They mediate their physiological effects through releasing Ca2+ from acidic organelles in response to cues such as the second messenger, NAADP (nicotinic acid adenine dinucleotide phosphate). Genetic knockout and pharmacological inhibition experiments demonstrate that the two-pore channels, TPC1 and TPC2, are required for infection by Filoviruses Ebola and Marburg in mice.(PMID: 29746898; PMID 25722412) Two pore segment channel 1 (TPC1) is a human protein encoded by the TPCN1 gene.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20607 Product name: Recombinant human TPCN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC136795 Sequence: MAVSLDDDVPLILTLDEGGSAPLAPSNGLGQEELPSKNGGSYAIHDSQAPSLSSGGESSPSSPAHNWEMNYQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLME Predict reactive species\nFull Name: two pore segment channel 1\nCalculated Molecular Weight: 816 aa, 94 kDa\nObserved Molecular Weight: 94 kDa\nGenBank Accession Number: BC136795\nGene Symbol: TPCN1\nGene ID (NCBI): 53373\nRRID: AB_2879317\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q9ULQ1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869388198057,"sku":"23758-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23758-1-ap","provider":"Iright","version":"1.0","type":"link"}