{"product_id":"proteintech-23778-1-ap","title":"Proteintech, 23778-1-AP, ADAM8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADAM8 (23778-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM8 in WB, IHC, ELISA applications with reactivity to human,   mouse samples\n23778-1-AP targets ADAM8 in WB, IHC, IP, ELISA applications and shows reactivity with human,   mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells,  mouse pancreas tissue\nPositive IHC detected in: human tonsillitis tissue,  human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADAMs are a large family of transmembrane proteins that are involved in proteolysis, making them candidates for mediating the remodeling of the extracellular matrix(ECM). ADAM8, one of the members of the ADAM family, is overexpressed in various human tumors. It has been shown previously that hypoxia influences the expression of some ADAM proteins. The protein found to be expressed in two active forms(90 kDa and 60 kDa): potential shedding protein and remnant protein in the pancreatic tissues under chronic pancreatitis and pancreatic cancer(PMID:18566576). The full length protein has a signal peptide and four glycosylation sites. This antibody is specific to ADAM8.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17262 Product name: Recombinant human ADAM8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 145-494 aa of BC115404 Sequence: EGGEGGRHAVYQAEHLLQTAGTCGVSDDSLGSLLGPRTAAVFRPRPGDSLPSRETRYVELYVVVDNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKLNFRVVLVGLEIWNSQDRFHVSPDPSVTLENLLTWQARQRTRRHLHDNVQLITGVDFTGTTVGFARVSAMCSHSSGAVNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQGCRCQERFEAGRCIMAGSIGSSFPRMFSDCSQAYLESFLERPQSVCLANAPDLSHLVGGPVCGNLFVERGEQCDCGPPEDCRNRCCNSTTCQLAEGAQCAHGTCCQECKVKPAGELCRPKKDMCDLEEFCDGRHPECPEDAFQEN Predict reactive species\nFull Name: ADAM metallopeptidase domain 8\nCalculated Molecular Weight: 824 aa, 89 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC115404\nGene Symbol: ADAM8\nGene ID (NCBI): 101\nRRID: AB_2879321\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P78325\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868909949097,"sku":"23778-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23778-1-ap","provider":"Iright","version":"1.0","type":"link"}