{"product_id":"proteintech-23805-1-ap","title":"Proteintech, 23805-1-AP, NRK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NRK1 (23805-1-AP) by Proteintech is a Polyclonal antibody targeting NRK1 in WB, IP, ELISA applications with reactivity to human, mouse samples\n23805-1-AP targets NRK1 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, mouse liver tissue\nPositive IP detected in: mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNRK1 (Nicotinamide riboside kinase 1) is necessary and rate-limiting for the use of exogenous NR and NMN for NAD þ synthesis. Functionally, NRK1 activity restrains CD4+ T cell activation and cytokine production and promotes survival. These activities are linked to increased NRK1 expression in the cytoplasm, where it locally elevates NAD\/H levels (PMID: 27725675, 29678570).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20746 Product name: Recombinant human C9orf95 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-199 aa of BC001366 Sequence: MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA Predict reactive species\nFull Name: chromosome 9 open reading frame 95\nCalculated Molecular Weight: 199 aa, 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC001366\nGene Symbol: C9orf95\nGene ID (NCBI): 54981\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q9NWW6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887742537897,"sku":"23805-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23805-1-ap","provider":"Iright","version":"1.0","type":"link"}