{"product_id":"proteintech-23809-1-ap","title":"Proteintech, 23809-1-AP, FATE1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FATE1 (23809-1-AP) by Proteintech is a Polyclonal antibody targeting FATE1 in WB, ELISA applications with reactivity to human,   mouse samples\n23809-1-AP targets FATE1 in WB, ELISA applications and shows reactivity with human,   mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue,  mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFATE1 ,also named as Fetal and adult testis expressed transcript protein, express predominantly in testis, with some expression in lung, heart, kidney, adrenal gland and whole brain. FATE might represent a novel target gene of SF-1 in testicular differentiation and germ cell development. FATE1 also involves in the regulation of a wide variety of cellular processes ,including the cell cycle, immune responses, signaling cascades and developmental events through target proteins, such as cyclins, cyclin-dependent kinase inhibitors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20757 Product name: Recombinant human FATE1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-163 aa of BC022064 Sequence: MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNMTATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATWRHRET Predict reactive species\nFull Name: fetal and adult testis expressed 1\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC022064\nGene Symbol: FATE1\nGene ID (NCBI): 89885\nRRID: AB_2879328\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q969F0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887635615913,"sku":"23809-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23809-1-ap","provider":"Iright","version":"1.0","type":"link"}