{"product_id":"proteintech-23823-1-ap","title":"Proteintech, 23823-1-AP, CNGA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CNGA2 (23823-1-AP) by Proteintech is a Polyclonal antibody targeting CNGA2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n23823-1-AP targets CNGA2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HepG2 cells,  mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCyclic nucleotide-gated (CNG) channels are crucial for visual and olfactory transductions (PMID: 12432397). Native CNG channels are heterotetramers composed of homologous A and B subunits. The olfactory CNG channels are composed of two CNGA2 subunits, one CNGA4 and one CNGB1b subunit, each containing a cyclic nucleotide-binding domain (PMID: 22786723). CNGA2, also named as CNCA, CNCA1 and CNCG2, is the primary subunit of the olfactory CNG channel. Odorant signal transduction is probably mediated by a G-protein coupled cascade using cAMP as second messenger. Activation of olfactory channel by cyclic nucleotides leads to a depolarization of olfactory sensory neurons.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19899 Product name: Recombinant human CNGA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 575-664 aa of BC126302 Sequence: REILMKEGLLDENEVATSMEVDVQEKLGQLETNMETLYTRFGRLLAEYTGAQQKLKQRITVLETKMKQNNEDDYLSDGMNSPELAAADEP Predict reactive species\nFull Name: cyclic nucleotide gated channel alpha 2\nCalculated Molecular Weight: 664 aa, 76 kDa\nObserved Molecular Weight: 80 kDa\nGenBank Accession Number: BC126302\nGene Symbol: CNGA2\nGene ID (NCBI): 1260\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q16280\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886665355433,"sku":"23823-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23823-1-ap","provider":"Iright","version":"1.0","type":"link"}