{"product_id":"proteintech-23826-1-ap","title":"Proteintech, 23826-1-AP, RSRC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RSRC1 (23826-1-AP) by Proteintech is a Polyclonal antibody targeting RSRC1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n23826-1-AP targets RSRC1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HepG2 cells\nPositive IHC detected in: human small intestine tissue,  human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRSRC1, also named as SRRP53, is a novel SR-related protein of an apparent molecular mass of 53 kDa (45-53 kDa). It is isolated in a gene trap screen that identifies proteins which localize to the nuclear speckles. RSRC1 plays a rol in pre-mRNA splicing and constitutive.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20604 Product name: Recombinant human RSRC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 172-334 aa of BC006982 Sequence: AGLEHLPPAEQAKARLQLVLEAAAKADEALKAKERNEEEAKRRKEEDQATLVEQVKRVKEIEAIESDSFVQQTFRSSKEVKKSVEPSEVKQATSTSGPASAVADPPSTEKEIDPTSIPTAIKYQDDNSLAHPNLFIEKADAEEKWFKRLIALRQERLMGSPVA Predict reactive species\nFull Name: arginine\/serine-rich coiled-coil 1\nCalculated Molecular Weight: 334 aa, 39 kDa\nObserved Molecular Weight: 38 kDa, 50 kDa\nGenBank Accession Number: BC006982\nGene Symbol: RSRC1\nGene ID (NCBI): 51319\nRRID: AB_2879329\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q96IZ7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869759492265,"sku":"23826-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23826-1-ap","provider":"Iright","version":"1.0","type":"link"}