{"product_id":"proteintech-23845-1-ap","title":"Proteintech, 23845-1-AP, NARG1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NARG1 (23845-1-AP) by Proteintech is a Polyclonal antibody targeting NARG1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n23845-1-AP targets NARG1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HEK-293 cells\nPositive IHC detected in: human stomach cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNAA15 (N-alpha-acetyltransferase 15) is a subunit of both the NatA and NatE complexes, and its role is to position the catalytic subunits in close vicinity to the nascent polypeptides (PMID: 33557580). Human NAA15 encodes an 866 amino acid (~105 kDa) protein, NAA15, containing tetratricopeptide repeat domains and a putative bipartite nuclear localization signal (PMID: 29656860). NAA15 was implicated in human disease and loss-of-function NAA15 variants in large cohorts of patients with autism spectrum disorder and\/or ID (PMID: 33103328).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20842 Product name: Recombinant human NARG1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-350 aa of BC093928 Sequence: MPAVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKEEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLLQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTSPDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLAVEETKGELLLQLCRLEDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKYPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKGCPPVFNTLRSLYKDKEKVAIIEELVVGYE Predict reactive species\nFull Name: NMDA receptor regulated 1\nCalculated Molecular Weight: 866 aa, 101 kDa\nObserved Molecular Weight: 95-100 kDa\nGenBank Accession Number: BC093928\nGene Symbol: NARG1\nGene ID (NCBI): 80155\nRRID: AB_2879338\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q9BXJ9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887732314281,"sku":"23845-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23845-1-ap","provider":"Iright","version":"1.0","type":"link"}