{"product_id":"proteintech-23872-1-ap","title":"Proteintech, 23872-1-AP, TRHR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRHR (23872-1-AP) by Proteintech is a Polyclonal antibody targeting TRHR in WB, ELISA applications with reactivity to human, mouse samples\n23872-1-AP targets TRHR in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRHR is a Gq-coupled neuroendocrine GPCR that mediates the actions of thyrotropin-releasing hormone in the anterior pituitary and brain. By activating PLC-Ca²⁺ signaling, TRHR controls TSH secretion, regulates thyroid hormone output, and influences metabolic rate and neuroendocrine behavior. Genetic or functional disruption of TRHR leads to central hypothyroidism and broader metabolic and neurological consequences, highlighting its essential role in HPT axis regulation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20612 Product name: Recombinant human TRHR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 310-398 aa of BC113360 Sequence: YLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKPANYSVALNYSVIKESDHFSTELDDITVTDTYLSATKVSFDDTCLASEVSFSQS Predict reactive species\nFull Name: thyrotropin-releasing hormone receptor\nCalculated Molecular Weight: 398 aa, 45 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC113360\nGene Symbol: TRHR\nGene ID (NCBI): 7201\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: P34981\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887838318761,"sku":"23872-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23872-1-ap","provider":"Iright","version":"1.0","type":"link"}