{"product_id":"proteintech-23895-1-ap","title":"Proteintech, 23895-1-AP, CEBPD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CEBPD (23895-1-AP) by Proteintech is a Polyclonal antibody targeting CEBPD in WB, ELISA applications with reactivity to human, mouse samples\n23895-1-AP targets CEBPD in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  MDA-MB-231 cells,  SK-BR-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCEBPD, a versatile transcription factor, belongs to the C\/EBP family that comprises three parts: an N-terminal transactivating region, a basic DNA binding region, and a C-terminal leucine zipper domain (PMID: 17170124). It presents as a regulator in terms of cell differentiation, proliferation, motility, growth arrest, and cell death (PMID: 24155666). The apparent molecular weight is larger than the calculated molecular weight of 28 kDa, which is likely due to posttranslational modification, presumably by ubiquitination.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20953 Product name: Recombinant human CEBPD protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-193 aa of BC105109 Sequence: MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPE Predict reactive species\nFull Name: CCAAT\/enhancer binding protein (C\/EBP), delta\nCalculated Molecular Weight: 269 aa, 28 kDa\nObserved Molecular Weight: 28-36 kDa\nGenBank Accession Number: BC105109\nGene Symbol: CEBPD\nGene ID (NCBI): 1052\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: P49716\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886446530729,"sku":"23895-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23895-1-ap","provider":"Iright","version":"1.0","type":"link"}