{"product_id":"proteintech-23937-1-ap","title":"Proteintech, 23937-1-AP, ACIN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACIN1 (23937-1-AP) by Proteintech is a Polyclonal antibody targeting ACIN1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n23937-1-AP targets ACIN1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nApoptosis is defined by several morphologic nuclear changes, including chromatin condensation and nuclear fragmentation. ACIN1 is a nuclear protein that induces apoptotic chromatin condensation after activation by caspase-3, without inducing DNA fragmentation. This protein has also been shown to be a component of a splicing-dependent multiprotein exon junction complex (EJC) that is deposited at splice junctions on mRNAs, as a consequence of pre-mRNA splicing. There are three isoforms of human acinus (the L, S and S' forms) shows at about 80-85 kDa and 220-250 kDa by Western Blot, which were probably generated by alternative splicing (PMID: 10490026). 23937-1-AP can detect all three isoforms of ACIN1. Another antibody 30522-1-AP specificly targets at the ACIN1-L.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21036 Product name: Recombinant human ACIN1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 979-1328 aa of BC140805 Sequence: TIDDPVRTAQVPSPPRGKISNIVHISNLVRPFTLGQLKELLGRTGTLVEEAFWIDKIKSHCFVTYSTVEEAVATRTALHGVKWPQSNPKFLCADYAEQDELDYHRGLLVDRPSETKTEEQGIPRPLHPPPPPPVQPPQHPRAEQREQERAVREQWAEREREMERRERTRSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKEKAQEEPPAKLLDDLFRKTKAAPCIYWLPLTDSQIVQKEAERAERAKEREKRRKEQEEEEQKEREKEAERERNRQLEREKRREHSRERDRERERERERDRGDRDRDRERDRERGRERDRRDTKRHSRSRSRSTPVRDRGGRR Predict reactive species\nFull Name: apoptotic chromatin condensation inducer 1\nCalculated Molecular Weight: 1341 aa, 152 kDa\nObserved Molecular Weight: 250 kDa, 80-85 kDa\nGenBank Accession Number: BC140805\nGene Symbol: ACIN1\nGene ID (NCBI): 22985\nRRID: AB_3085716\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UKV3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869800157353,"sku":"23937-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23937-1-ap","provider":"Iright","version":"1.0","type":"link"}