{"product_id":"proteintech-23966-1-ap","title":"Proteintech, 23966-1-AP, STRN3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STRN3 (23966-1-AP) by Proteintech is a Polyclonal antibody targeting STRN3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n23966-1-AP targets STRN3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21091 Product name: Recombinant human STRN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 207-300 aa of BC126221 Sequence: SNSEPNGSVETKNLEQILNGGESPKQKGQEIKRSSGDVLETFNFLENADDSDEDEENDMIEGIPEGKDKHRMNKHKIGNEGLAADLTDDPDTEE Predict reactive species\nFull Name: striatin, calmodulin binding protein 3\nCalculated Molecular Weight: 797 aa, 87 kDa\nObserved Molecular Weight: 90-100 kDa\nGenBank Accession Number: BC126221\nGene Symbol: STRN3\nGene ID (NCBI): 29966\nRRID: AB_2879379\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q13033\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869433385129,"sku":"23966-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23966-1-ap","provider":"Iright","version":"1.0","type":"link"}