{"product_id":"proteintech-23976-1-ap","title":"Proteintech, 23976-1-AP, BARHL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BARHL2 (23976-1-AP) by Proteintech is a Polyclonal antibody targeting BARHL2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human,   mouse samples\n23976-1-AP targets BARHL2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human,   mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  NIH\/3T3 cells\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBARHL2 also named as BarH like homeobox 2 is 279 amino acid protein, which contains 1 homeobox DNA-binding domain. BARHL2 localizes in nucleus and belongs to BAR homeobox family. BARHL2 as a transcription factor binds optimally to the DNA consensus sequence. Barx2 may differentially control the expression of L1 and other target genes during embryonic development. Barx2 is expressed in several smooth muscle-containing tissues, as well as skeletal muscle, brain, tongue and esophagus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21156 Product name: Recombinant human BARHL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC126439 Sequence: MTMEGASGSSFGIDTILSSASSGSPGMMNGDFRPLGEARTADFRSQATPSPCSEIDTVGTAPSSPISVTMEPPEPHLVADATQHHHHLHHSQQPPPPAAAPTQSLQPLPQQQQPLPPQQPPPPPPQQLGSAASAPRTSTSS Predict reactive species\nFull Name: BarH-like homeobox 2\nCalculated Molecular Weight: 387 aa, 42 kDa\nObserved Molecular Weight: 42-45 kDa\nGenBank Accession Number: BC126439\nGene Symbol: BARHL2\nGene ID (NCBI): 343472\nRRID: AB_2879386\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q9NY43\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869642117289,"sku":"23976-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23976-1-ap","provider":"Iright","version":"1.0","type":"link"}