{"product_id":"proteintech-23992-1-ap","title":"Proteintech, 23992-1-AP, TMEM55B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM55B (23992-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM55B in WB, IP, ELISA applications with reactivity to human,  mouse, rat samples\n23992-1-AP targets TMEM55B in WB, IHC, IP, ELISA applications and shows reactivity with human,  mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse heart tissue,  A549 cells,  HepG2 cells,  MCF-7 cells,  rat heart tissue\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM55B is also named as C14orf9 and PIP4P1. TMEM55B is originally identified as phosphatidylinositol-4,5-P24-phosphatases (PtdIns-4,5-P24-phosphatases) that catalyze dephosphorylation of PtdIns-4,5-P2 to PtdIns-5-P. The transmembrane protein TMEM55B is involved in the perinuclear clustering of lysosomes upon starvation. TMEM55B expression is upregulated upon starvation via TFEB and TFE3 activation, and loss of TMEM55B diminishes starvation-induced lysosomal clustering. TMEM55B can bind to the dynein adaptor JIP4, promoting dynein-dynactin-dependent lysosomal trafficking to the perinuclear region. TMEM55B is also suggested to contribute to lysosomal homeostasis and mTORC1 activation via the V-ATPase assembly (PMID: 33537719).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21172 Product name: Recombinant human TMEM55B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-83 aa of BC002867 Sequence: IDGGAGGNGLVGPGGSGAGPGGGLTPSAPPYGAAFPPFPEGHPAVLPGEDPPPYSPLTSPDSGSAPMIT Predict reactive species\nFull Name: transmembrane protein 55B\nCalculated Molecular Weight: 277 aa, 29 kDa\nObserved Molecular Weight: 29-32 kDa\nGenBank Accession Number: BC002867\nGene Symbol: TMEM55B\nGene ID (NCBI): 90809\nRRID: AB_2879391\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86T03\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868961558697,"sku":"23992-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23992-1-ap","provider":"Iright","version":"1.0","type":"link"}