{"product_id":"proteintech-23996-1-ap","title":"Proteintech, 23996-1-AP, TFAM Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TFAM (23996-1-AP) by Proteintech is a Polyclonal antibody targeting TFAM in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n23996-1-AP targets TFAM in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HEK-293 cells,  HL-60 cells,  HeLa cells,  MCF-7 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTFAM, also named as TCF6L2, MtTF1, TCF6, TCF6L1, TCF6L3 and mtTFA, is a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. It is involved in mitochondrial transcription regulation. TFAM is required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. It activates transcription by binding immediately upstream of transcriptional start sites. TFAM is able to unwind and bend DNA.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21196 Product name: Recombinant human TFAM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-118 aa of BC126366 Sequence: PKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFK Predict reactive species\nFull Name: transcription factor A, mitochondrial\nCalculated Molecular Weight: 246 aa, 29 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC126366\nGene Symbol: TFAM\nGene ID (NCBI): 7019\nRRID: AB_2879395\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q00059\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868914897065,"sku":"23996-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23996-1-ap","provider":"Iright","version":"1.0","type":"link"}