{"product_id":"proteintech-23999-1-ap","title":"Proteintech, 23999-1-AP, ANKRD29 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANKRD29 (23999-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD29 in WB, IP, ELISA applications with reactivity to human,  mouse samples\n23999-1-AP targets ANKRD29 in WB, IP, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IP detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21201 Product name: Recombinant human ANKRD29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 111-175 aa of BC030622 Sequence: DEGTALLAASQYGHMQVVETLLKHGANIHDQLYDGATALFLAAQGGYLDVIRLLLASGAKVNQPR Predict reactive species\nFull Name: ankyrin repeat domain 29\nCalculated Molecular Weight: 301 aa, 33 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC030622\nGene Symbol: ANKRD29\nGene ID (NCBI): 147463\nRRID: AB_2879398\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q8N6D5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869635825833,"sku":"23999-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-23999-1-ap","provider":"Iright","version":"1.0","type":"link"}