{"product_id":"proteintech-24000-1-ap","title":"Proteintech, 24000-1-AP, ANKRD13C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANKRD13C (24000-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD13C in WB, ELISA applications with reactivity to human,   mouse samples\n24000-1-AP targets ANKRD13C in WB, ELISA applications and shows reactivity with human,   mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse testis tissue,  MDA-MB-231 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nANKRD13C, also termed as ankyrin repeat domain 13C, belongs to the ankyrin repeat domain  13 family. ANKRD13C is localized on ER membranes where it binds to DP to control its biogenesis and trafficking. ANKRD13C modulates the expression and maturation of other G pretein coupled receptors as well, indicating that ANKRD13C is a novel regulator of the biogenesis and trafficking of G pretein coupled receptors through the biosynthetic pathway.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21202 Product name: Recombinant human ANKRD13C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC028840 Sequence: MTGEKIRSLRRDHKPSKEEGDLLEPGDEEAAAALGGTFTRSRIGKGGKACHKIFSNHHHRLQLKAAPASSNPPGAPALPLHNSSVTANSQSPALLAGTNPVAVVADGGSCPAHYPVHECVFKGDVRRLSSLIRTHNIGQKDNHG Predict reactive species\nFull Name: ankyrin repeat domain 13C\nCalculated Molecular Weight: 541 aa, 61 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC028840\nGene Symbol: ANKRD13C\nGene ID (NCBI): 81573\nRRID: AB_2879399\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q8N6S4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884970365097,"sku":"24000-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24000-1-ap","provider":"Iright","version":"1.0","type":"link"}