{"product_id":"proteintech-24015-1-ap","title":"Proteintech, 24015-1-AP, MUTED\/BLOC1S5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MUTED\/BLOC1S5 (24015-1-AP) by Proteintech is a Polyclonal antibody targeting MUTED\/BLOC1S5 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n24015-1-AP targets MUTED\/BLOC1S5 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBLOC1S5 (biogenesis of lysosomal organelles complex 1 subunit 5) encodes a subunit of the BLOC1, a complex that is involved in transport of some but not all cargo to the lysosome and lysosome-related organelles. BLOC1S5 has a crucial role in STING-mediated cell death upon stimulation with low concentrations of CMA(PMID: 29033128).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21226 Product name: Recombinant human MUTED protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC119644 Sequence: MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGLREMRVLENLKNMIHETNEHTLPKCRDTMRDSLSQVLQR Predict reactive species\nFull Name: muted homolog (mouse)\nCalculated Molecular Weight: 187 aa, 22 kDa\nObserved Molecular Weight: 22-25 kDa\nGenBank Accession Number: BC119644\nGene Symbol: MUTED\nGene ID (NCBI): 63915\nRRID: AB_2879402\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TDH9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869474410665,"sku":"24015-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24015-1-ap","provider":"Iright","version":"1.0","type":"link"}