{"product_id":"proteintech-24046-1-ap","title":"Proteintech, 24046-1-AP, ZDHHC9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZDHHC9 (24046-1-AP) by Proteintech is a Polyclonal antibody targeting ZDHHC9 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n24046-1-AP targets ZDHHC9 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, SH-SY5Y cells,  mouse skeletal muscle tissue,  mouse brain tissue\nPositive IHC detected in: human testis tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZDHHC9, also named as CXorf11, ZDHHC10, ZNF379 or ZNF380, is a 364 amino acid protein, which contains one DHHC-type zinc finger and belongs to the DHHC palmitoyltransferase activity. ZDHHC9 localizes in the endoplasmic reticulum membrane and is highly expressed in kidney, skeletal muscle, brain, lung and liver. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20881 Product name: Recombinant human ZDHHC9 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 87-364 aa of BC006200 Sequence: SFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLEESGSRPPSTQETSSSLLPQSPAPTEHLNSNEMPEDSSTPEEMPPPEPPEPPQEAAEAEK Predict reactive species\nFull Name: zinc finger, DHHC-type containing 9\nCalculated Molecular Weight: 41 kDa\nObserved Molecular Weight: 38-48 kDa\nGenBank Accession Number: BC006200\nGene Symbol: ZDHHC9\nGene ID (NCBI): 51114\nRRID: AB_2879415\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q9Y397\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869441020073,"sku":"24046-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24046-1-ap","provider":"Iright","version":"1.0","type":"link"}