{"product_id":"proteintech-24065-1-ap","title":"Proteintech, 24065-1-AP, NHEDC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NHEDC2 (24065-1-AP) by Proteintech is a Polyclonal antibody targeting NHEDC2 in WB, IHC, ELISA applications with reactivity to human samples\n24065-1-AP targets NHEDC2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma tissue\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNHEDC2, also named as NHA2 and SLC9B2, contributes to the organellar volume homeostasis. It is required for osteoclast differentiation and bone resorption activity. NHEDC2 has two isoforms with MW 48 kDa and 58 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21141 Product name: Recombinant human NHEDC2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-156 aa of BC047447 Sequence: MGDEDKRITYEDSEPSTGMNYTPSMHQEAQEETVMKLKGIDANEPTEGSILLKSSEKKLQETPTEANHVQRLRQMLACPPHGLLDRVITNVTIIVLLWAVVWSITGSECLPGGNLFGIIILFYCAIIGGKLLGLIKLPTLPPLPSLLGMLLAGFLI Predict reactive species\nFull Name: Na+\/H+ exchanger domain containing 2\nCalculated Molecular Weight: 537 aa, 58 kDa\nObserved Molecular Weight: ~55 kDa\nGenBank Accession Number: BC047447\nGene Symbol: NHEDC2\nGene ID (NCBI): 133308\nRRID: AB_2879423\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q86UD5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887736770729,"sku":"24065-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24065-1-ap","provider":"Iright","version":"1.0","type":"link"}