{"product_id":"proteintech-24085-1-ap","title":"Proteintech, 24085-1-AP, FRYL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FRYL (24085-1-AP) by Proteintech is a Polyclonal antibody targeting FRYL in WB, ELISA applications with reactivity to human, mouse samples\n24085-1-AP targets FRYL in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells, HEK-293 cells,  HeLa cells,  U2OS cells,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFRYL, or FRY-like transcription coactivator, is a protein that belongs to the Furry protein family, which is evolutionarily conserved from yeast to humans. FRYL has almost identical functional domains to the well-characterized Fry protein, which is involved in many processes, including cell polarization, regulation of the actin cytoskeleton, and patterning of sensory neuron dendritic fields (PMID: 34386489). FRYL is a prognostic marker in certain cancers, including Kidney renal clear cell carcinoma, Ovary serous cystadenocarcinoma, and Rectum adenocarcinoma, suggesting its potential role in cancer progression.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21333 Product name: Recombinant human FRYL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2605-2654 aa of BC021803 Sequence: MPEPLAPESYPESVCEEDVTLALKELDERCEEEEADFSGLSSQDEEEQDG Predict reactive species\nFull Name: FRY-like\nCalculated Molecular Weight: 3013 aa, 340 kDa\nObserved Molecular Weight: 340 kDa\nGenBank Accession Number: BC021803\nGene Symbol: FRYL\nGene ID (NCBI): 285527\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: O94915\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887643742377,"sku":"24085-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24085-1-ap","provider":"Iright","version":"1.0","type":"link"}