{"product_id":"proteintech-24162-1-ap","title":"Proteintech, 24162-1-AP, NPBWR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NPBWR2 (24162-1-AP) by Proteintech is a Polyclonal antibody targeting NPBWR2 in IHC, ELISA applications with reactivity to human samples\n24162-1-AP targets NPBWR2 in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNPBWR1 (GPR7) and NPBWR2 (GPR8) are two structurally related G-protein coupled receptors. These two receptors share high sequence identity to each other and significant similarity with opioid and somatostatin receptors (PMID: 10407191). Neuropeptide B (NPB) and neuropeptide W (NPW) are endogenous peptide ligands of these receptors. NPBWR1 was found highly conserved in both human and rodents while NPBWR2 gene was not found in the rodent genomes (PMID: 7590751; 10407191). NPBWR1 and NPBWR2 are implicated in energy homeostasis, pain, and emotion (PMID: 23515889).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20874 Product name: Recombinant human NPBWR2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-211 aa of BC067481 Sequence: MQAAGHPEPLDSRGSFSLPTMGANVSQDNGTGHNATFSEPLPFLYVLLPAVYSGICAVGLTGNTAVILVILRAPKMKTVTNVFILNLAVADGLFTLVLPVNIAEHLLQYWPFGELLCKLVLAVDHYNIFSSIYFLAVMSVDRYLVVLATVRSRHMPWRTYRGAKVASLCVWLGVTVLVLPFFSFAGVYSNELQVPSCGLSFPWPEQVWFKA Predict reactive species\nFull Name: neuropeptides B\/W receptor 2\nCalculated Molecular Weight: 333 aa, 37 kDa\nGenBank Accession Number: BC067481\nGene Symbol: NPBWR2\nGene ID (NCBI): 2832\nRRID: AB_2879442\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: P48146\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887740670121,"sku":"24162-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24162-1-ap","provider":"Iright","version":"1.0","type":"link"}