{"product_id":"proteintech-24168-1-ap","title":"Proteintech, 24168-1-AP, XBP1S\/XBP1U Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe XBP1S\/XBP1U (24168-1-AP) by Proteintech is a Polyclonal antibody targeting XBP1S\/XBP1U in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n24168-1-AP targets XBP1S\/XBP1U in WB, IHC, FC (Intra), ChIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HEK-293 cells,  Jurkat cells,  Raji cells\nPositive IHC detected in: human breast cancer tissue, mouse liver tissue,  human colon cancer tissue,  human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nXBP1 is also named as XBP2, belongs to the bZIP family. The X-box-binding protein-1 (XBP1) is a transcriptional regulator of the ER stress response that lies downstream of inositol-requiring enzyme 1 (IRE1α) activation (PMID: 14559994). IRE1α possesses both kinase and ribonuclease activity and processes XBP1 mRNA to produce an active transcription factor in response to ER stress (PMID: 11779464, 11780124). \nIt has been found that upon accumulation of unfolded proteins in the endoplasmic reticulum, the mRNA of this gene is processed to an active form by an unconventional splicing mechanism that is mediated by the endonuclease inositol-requiring enzyme 1. The resulting loss of 26 nt from the spliced mRNA causes a frame-shift and an isoform XBP1S, which is the functionally active transcription factor. The isoform encoded by the unspliced mRNA, XBP1U, is constitutively expressed, and thought to function as a negative feedback regulator of XBP1S, which shuts off transcription of target genes during the recovery phase of ER stress (PMID: 11850408). The unspliced XBP1U isoform is composed of 261 amino acid residues, and the spliced XBP1S isoform is composed of 376 amino acid residues. The XBP1 antibody (24168-1-AP) can detect both XBP1U and XBP1S.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21454 Product name: Recombinant human XBP1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-167 aa of BC000938 Sequence: MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAAL Predict reactive species\nFull Name: X-box binding protein 1\nCalculated Molecular Weight: 261 aa, 29 kDa\nObserved Molecular Weight: ~32 kDa; ~60 kDa\nGenBank Accession Number: BC000938\nGene Symbol: XBP1\nGene ID (NCBI): 7494\nRRID: AB_2879445\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: P17861\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868892680361,"sku":"24168-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24168-1-ap","provider":"Iright","version":"1.0","type":"link"}