{"product_id":"proteintech-24272-1-ap","title":"Proteintech, 24272-1-AP, Frizzled 2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Frizzled 2 (24272-1-AP) by Proteintech is a Polyclonal antibody targeting Frizzled 2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n24272-1-AP targets Frizzled 2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, mouse colon tissue,  rat kidney tissue,  HEK-293 cells,  mouse colon tisue\nPositive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFrizzled 2(FZD2) also known as FzE2, which belongs to the G-protein coupled receptor Fz\/Smo family. FZD2 is an important receptor in the Wnt pathway, which is highly expressed in malignant tumors and helps regulate multiple tumor behaviors. Its expression level is related to prognosis. Moreover, high level of FZD2 had significant correlation with poor prognosis in Breast cancer (BC) patients(PMID: 33832493).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18003 Product name: Recombinant human FZD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 138-217 aa of BC113402 Sequence: CEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLG Predict reactive species\nFull Name: frizzled homolog 2 (Drosophila)\nCalculated Molecular Weight: 565 aa, 64 kDa\nObserved Molecular Weight: 64-70 kDa\nGenBank Accession Number: BC113402\nGene Symbol: Frizzled 2\nGene ID (NCBI): 2535\nRRID: AB_2879463\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14332\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868901888169,"sku":"24272-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24272-1-ap","provider":"Iright","version":"1.0","type":"link"}