{"product_id":"proteintech-24288-1-ap","title":"Proteintech, 24288-1-AP, MIF4GD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MIF4GD (24288-1-AP) by Proteintech is a Polyclonal antibody targeting MIF4GD in WB, IHC, ELISA applications with reactivity to human, mouse samples\n24288-1-AP targets MIF4GD in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMIF4GD (MIF4G domain containing), also known as MIFD, AD023, or SLIP1, is a 222 amino acid protein that contains one MIF4G domain. Localized to both the nucleus and the cytoplasm, MIF4GD plays a role in the replication-dependent translation of histone mRNAs, which differ from most eukaryotic mRNAs in that they end with a stem-loop instead of a poly-A tail. Specifically, MIF4GD interacts with SLBP, eIF4G and DAP-5. Via its interaction with SLBP, MIF4GD is thought to be tethered to the stem loops of histone mRNAs where it may facilitate the circularizing of the mRNAs, thereby enhancing their translation. Depletion of MIF4GD results in reduced histone translation and may lead to cell death, suggesting that MIF4GD plays an important role in cell survival. Two isoforms of MIF4GD exist due to alternative splicing events.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17931 Product name: Recombinant human MIF4GD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-256 aa of BC033759 Sequence: EPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSRLMPSRCNTQYRDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGLLNRLQQEYQAREQLRARSLQGWVCYVTFICNIFDYLRVNNMPMMALVNPVYDCLFRLAQPDSLSKEEEVDCLVLQLHRVGEQLEKMNGQRMDELFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD Predict reactive species\nFull Name: MIF4G domain containing\nCalculated Molecular Weight: 256 aa, 29 kDa\nObserved Molecular Weight: ~25 kDa\nGenBank Accession Number: BC033759\nGene Symbol: MIF4GD\nGene ID (NCBI): 57409\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A9UHW6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887719567529,"sku":"24288-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24288-1-ap","provider":"Iright","version":"1.0","type":"link"}