{"product_id":"proteintech-24290-1-ap","title":"Proteintech, 24290-1-AP, CSTF3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CSTF3 (24290-1-AP) by Proteintech is a Polyclonal antibody targeting CSTF3 in WB, IHC, IP, ELISA applications with reactivity to human samples\n24290-1-AP targets CSTF3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, K-562 cells,  HEK-293 cells\nPositive IP detected in: A431 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17930 Product name: Recombinant human CSTF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC059948 Sequence: MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN Predict reactive species\nFull Name: cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa\nCalculated Molecular Weight: 717 aa, 83 kDa\nObserved Molecular Weight: 77-83 kDa\nGenBank Accession Number: BC059948\nGene Symbol: CSTF3\nGene ID (NCBI): 1479\nRRID: AB_2879475\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q12996\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869454749865,"sku":"24290-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24290-1-ap","provider":"Iright","version":"1.0","type":"link"}