{"product_id":"proteintech-24294-1-ap","title":"Proteintech, 24294-1-AP, peptide YY Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe peptide YY (24294-1-AP) by Proteintech is a Polyclonal antibody targeting peptide YY in IHC, ELISA applications with reactivity to human samples\n24294-1-AP targets peptide YY in WB, IF, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human pancreas tissue,  human colon tissue,  human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17939 Product name: Recombinant human PYY protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-97 aa of BC041057 Sequence: YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW Predict reactive species\nFull Name: peptide YY\nCalculated Molecular Weight: 97 aa, 11 kDa\nGenBank Accession Number: BC041057\nGene Symbol: Peptide YY\nGene ID (NCBI): 5697\nRRID: AB_2879477\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10082\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869482242217,"sku":"24294-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24294-1-ap","provider":"Iright","version":"1.0","type":"link"}