{"product_id":"proteintech-24311-1-ap","title":"Proteintech, 24311-1-AP, KDM2A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KDM2A (24311-1-AP) by Proteintech is a Polyclonal antibody targeting KDM2A in WB, IP, ELISA applications with reactivity to human, mouse samples\n24311-1-AP targets KDM2A in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HeLa cells,  NIH\/3T3 cells\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKDM2A(Lysine-specific demethylase 2A) is also named as CXXC8, FBL7, FBXL11, JHDM1A, KIAA1004 and belongs to the JHDM1 histone demethylase family. It is required to maintain the heterochromatic state, and playing a role in epigenetic silencing. KDM2A is one of the four subunits of the E3 ubiquitin protein ligase complex (SCF) with SKP1, CUL1, RBX1, Fbox protein bringing ubiquitin conjugating enzymes to substrates recruited by F-box.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19448 Product name: Recombinant human KDM2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 374-558 aa of BC064360 Sequence: DEEAVDREPRRLSSRRSVLTSPVANGVNLDYDGLGKTCRSLPSLKKTLAGDSSSDCSRGSHNGQVWDPQCAPRKDRQVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELANSDPKLALTGVPIVQWPKRDKLKFPTRPKVRVPTIPITKPHTMKPAPRLTPVRPAAAS Predict reactive species\nFull Name: lysine (K)-specific demethylase 2A\nCalculated Molecular Weight: 1162 aa, 133 kDa\nObserved Molecular Weight: 126 kDa\nGenBank Accession Number: BC064360\nGene Symbol: KDM2A\nGene ID (NCBI): 22992\nRRID: AB_2879488\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2K7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868942160041,"sku":"24311-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24311-1-ap","provider":"Iright","version":"1.0","type":"link"}