{"product_id":"proteintech-24313-1-ap","title":"Proteintech, 24313-1-AP, LYSMD3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LYSMD3 (24313-1-AP) by Proteintech is a Polyclonal antibody targeting LYSMD3 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n24313-1-AP targets LYSMD3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Neuro-2a cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLYSMD3 also termed as LysM and putative peptidoglycan binding domain containing protein 3 is  a 306 amino acid single-pass membrane protein that contains one LysM repeat. LysM domain encoding genes may play a role in brain and in nervous system development and functioning. LYSMD3, shows a high level of central nervous expression during embryogenesis and is also, therefore, a good candidate gene for other central nervous system (CNS) symptoms, such as psychomotor retardation, brain anomalies and muscular hypotonia of the 5q14.3 microdeletion syndrome.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19430 Product name: Recombinant human LYSMD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC136741 Sequence: MAGRHQNRSFPLPGVQSSGQVHAFGNCSDSDILEEDAEVYELRSRGKEKVRRSTSRDRLDDIIVLTKDIQEGDTLNAIALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKKFSSLTETLCPPKGRQTSRHSSVQYSSEQQ Predict reactive species\nFull Name: LysM, putative peptidoglycan-binding, domain containing 3\nCalculated Molecular Weight: 306 aa, 35 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC136741\nGene Symbol: LYSMD3\nGene ID (NCBI): 116068\nRRID: AB_2879490\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z3D4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869470576809,"sku":"24313-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24313-1-ap","provider":"Iright","version":"1.0","type":"link"}