{"product_id":"proteintech-24319-1-ap","title":"Proteintech, 24319-1-AP, C5orf24 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C5orf24 (24319-1-AP) by Proteintech is a Polyclonal antibody targeting C5orf24 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples\n24319-1-AP targets C5orf24 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human pancreas tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\nPositive FC (Intra) detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC5orf24 is a cellular transcriptional regulator that performs different functions in different cell types, including the processes of cell proliferation, cell polarization, migration, and tumor development.C5orf24 is able to specifically and efficiently capture a wide range of tuberculosis antigens, which is important for the diagnosis of tuberculosis. C5orf24 has two isoforms with MW 20 kDa and 16 kDa. For phosphoserine modification, the MW is about 20-23 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19534 Product name: Recombinant human C5orf24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC053677 Sequence: MMHPVASSNPAFCGPGKPSCLNEDAMRAADQFDIYSSQQSKYSHTVNHKPMVCQRQDPLNETHLQTTSGRSIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGRPPGS Predict reactive species\nFull Name: chromosome 5 open reading frame 24\nCalculated Molecular Weight: 188 aa, 20 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC053677\nGene Symbol: C5orf24\nGene ID (NCBI): 134553\nRRID: AB_2879491\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z6I8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869647294633,"sku":"24319-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24319-1-ap","provider":"Iright","version":"1.0","type":"link"}