{"product_id":"proteintech-24321-1-ap","title":"Proteintech, 24321-1-AP, FXI Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FXI (24321-1-AP) by Proteintech is a Polyclonal antibody targeting FXI in WB, ELISA applications with reactivity to human, rat samples\n24321-1-AP targets FXI in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFactor XI (FXI) is the zymogen of a blood coagulation protease, factor XIa (FXIa), that contributes to hemostasis by activating factor IX. Factor XI is a precursor of an S1 serine protease found in blood plasma. When activated to FXIa, it plays a crucial role in forming and stabilizing fibrin by triggering the activation of factor IX (PMID: 38545505). FXI has 2 isoforms with the molecular mass of 70 kDa and 64 kDa. Isoform 2 is produced by platelets and megakaryocytes but absent from other blood cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18004 Product name: Recombinant human F11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 58-397 aa of BC119014 Sequence: LFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPRIVGGTASVRG Predict reactive species\nFull Name: coagulation factor XI\nCalculated Molecular Weight: 625 aa, 70 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC119014\nGene Symbol: F11\nGene ID (NCBI): 2160\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P03951\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887644627113,"sku":"24321-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24321-1-ap","provider":"Iright","version":"1.0","type":"link"}