{"product_id":"proteintech-24327-1-ap","title":"Proteintech, 24327-1-AP, SGLT3\/SLC5A4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SGLT3\/SLC5A4 (24327-1-AP) by Proteintech is a Polyclonal antibody targeting SGLT3\/SLC5A4 in WB, IP, IHC, ELISA applications with reactivity to human,  mouse,  rat samples\n24327-1-AP targets SGLT3\/SLC5A4 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue\nPositive IP detected in: mouse kidney tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC5A4, also known as SGLT3, is a sugar sensor that depolarizes the plasma membrane in response to external glucose (PMID: 12748858, 20421923). SGLT3 mediates the influx of sodium ions into the cell but does not transport sugars, also potently activated by imino sugars such as deoxynojirimycin (PMID: 22766068, 13130073). SGLT3 is a plasma membrane protein, shares 70% identity with SGLT1, and is expressed in the small intestine (cholinergic neurons), skeletal muscle, kidney, uterus, and testis (PMID: 12748858). SGLT3 protein at apparent molecular masses of 72 kDa and 80 kDa in human kidney tissue and HK-2 cells (PMID: 22766068).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19391 Product name: Recombinant human SLC5A4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 579-633 aa of BC153069 Sequence: SQEETDDGVEEDYPEKSRGCLKKAYDLFCGLQKGPKLTKEEEEALSKKLTDTSER Predict reactive species\nFull Name: solute carrier family 5 (low affinity glucose cotransporter), member 4\nCalculated Molecular Weight: 659 aa, 72 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC153069\nGene Symbol: SGLT3\nGene ID (NCBI): 6527\nRRID: AB_2650519\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NY91\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869498298537,"sku":"24327-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24327-1-ap","provider":"Iright","version":"1.0","type":"link"}