{"product_id":"proteintech-24331-1-ap","title":"Proteintech, 24331-1-AP, TMEM9B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM9B (24331-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM9B in WB, IHC, ELISA applications with reactivity to human,  rat,  mouse samples\n24331-1-AP targets TMEM9B in WB, IHC, ELISA applications and shows reactivity with human,  rat,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat liver tissue,  mouse colon tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM9B, also termed as Transmembrane protein 9B encodes a 198 amino-acidprotein that contains an N-terminal signal peptide, a single transmembrane region, three potential N-glycosylation sites, and three conserved cys-rich domains in the N-terminus. There is a dimer form of TMEM9B protein (PMID: 12359240). TMEM9B mRNA is expressed in a wide range of tissues and cells. TMEM9B is a lysosomal transmembrane protein that regulates the activity of inflammatory signaling pathways.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19383 Product name: Recombinant human TMEM9B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 80-172 aa of BC040124 Sequence: PDVEAYCLRCECKYEERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKV Predict reactive species\nFull Name: TMEM9 domain family, member B\nCalculated Molecular Weight: 198 aa, 23 kDa\nObserved Molecular Weight: 23 kDa, 35 kDa\nGenBank Accession Number: BC040124\nGene Symbol: TMEM9B\nGene ID (NCBI): 56674\nRRID: AB_2879497\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQ34\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869778694313,"sku":"24331-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24331-1-ap","provider":"Iright","version":"1.0","type":"link"}