{"product_id":"proteintech-24344-1-ap","title":"Proteintech, 24344-1-AP, ERP29 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ERP29 (24344-1-AP) by Proteintech is a Polyclonal antibody targeting ERP29 in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n24344-1-AP targets ERP29 in WB, IHC, IF\/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, HEK-293 cells,  HeLa cells,  mouse kidney tissue,  mouse liver tissue,  mouse lung tissue,  rat testis tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human liver cancer tissue, human breast cancer tissue,  human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver cancer tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEndoplasmic reticulum resident protein 29 (ERP29) is a 29-kDa endoplasmic reticulum (ER) luminal protein. Structurally ERp29 is related to protein disulfide isomerases (PDI). However, it lacks the thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase (PMID: 15500441). ERP29 plays an important role in the processing of secretory proteins within the (ER), possibly by participating in the folding of proteins in the ER. The secretion of thyroglobulin (TG) was found to be strongly regulated by ERP29 (PMID: 16380091).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19451 Product name: Recombinant human ERP29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-261 aa of BC101495 Sequence: PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL Predict reactive species\nFull Name: endoplasmic reticulum protein 29\nCalculated Molecular Weight: 261 aa, 29 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC101495\nGene Symbol: ERP29\nGene ID (NCBI): 10961\nRRID: AB_2879503\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P30040\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869535260841,"sku":"24344-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24344-1-ap","provider":"Iright","version":"1.0","type":"link"}