{"product_id":"proteintech-24347-1-ap","title":"Proteintech, 24347-1-AP, SHLD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SHLD1 (24347-1-AP) by Proteintech is a Polyclonal antibody targeting SHLD1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n24347-1-AP targets SHLD1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSHLD1, also known as FAM35A, is a key protein in the field of DNA damage repair. As a core component of the Shieldin complex, SHLD1 plays a critical role in maintaining genomic stability. Its primary function is to inhibit the resection of DNA double-strand break ends, directing repair toward the non-homologous end joining pathway while suppressing accurate homologous recombination repair.\nThis function makes SHLD1 an important target for cancer therapy. In BRCA-mutant tumors, the expression level of SHLD1 directly affects the efficacy of PARP inhibitors-intact SHLD1 function renders cancer cells sensitive to the drugs, while its loss leads to drug resistance. Therefore, SHLD1 is not only a fundamental element in basic research on DNA damage response mechanisms but also a highly valuable tumor biomarker and prognostic indicator, offering new directions for personalized cancer treatment.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19727 Product name: Recombinant human C20orf196 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC035800 Sequence: MAARDATSGSLSEESSALDLPSACDIRDYVLQGPSQEANSEAFSSLEFHSFPYSSDVDPDTSNLNIEQNNSWTAENFWLDPAVKGQSEKEEDDGLRKSLDRFYEMFGHPQPGSANSLSASVCKCLSQKITQLRGQESQKYA Predict reactive species\nFull Name: chromosome 20 open reading frame 196\nCalculated Molecular Weight: 205 aa, 23 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC035800\nGene Symbol: C20orf196\nGene ID (NCBI): 149840\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IYI0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887801225385,"sku":"24347-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24347-1-ap","provider":"Iright","version":"1.0","type":"link"}