{"product_id":"proteintech-24361-1-ap","title":"Proteintech, 24361-1-AP, TMEM25 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM25 (24361-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM25 in WB, IHC, ELISA applications with reactivity to human,  mouse,  rat samples\n24361-1-AP targets TMEM25 in WB, IF, IHC, CoIP, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM25 is a novel member of the immunoglobulin superfamily. BC042896 and AY358919 cDNAs are derived from human TMEM25 gene. TMEM25 isoform 1 (BC042896), consisting of exons 1-9, encodes a 366-aa transmembrane protein. TMEM25 isoform 2 (AY358919), consisting of exons 1-4 and 6-9, encodes a 322-aa secreted protein (PMID:15254712). Human TMEM25 gene  are found to encode transmembrane-type as well as secreted-type proteins due to alternative splicing of exon-skipping type. TMEM25 mRNA is expressed in brain, including cerebellar cortex and hippocampus, as well as in neuroblastoma, brain tumors, and gastric cancer. TMEM25 is a target of pharmacogenomics in the field of oncology and regenerative medicine. TMEM25 mRNAs may be useful members of a panel of favorable prognostic and predictive markers for breast cancer( PMID:19776672).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19964 Product name: Recombinant human TMEM25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-323 aa of BC051841 Sequence: LEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPGPSRHPSLISSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSRGFIRLPVLGYIYRVSSVSSDEIWL Predict reactive species\nFull Name: transmembrane protein 25\nCalculated Molecular Weight: 366 aa, 39 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC051841\nGene Symbol: TMEM25\nGene ID (NCBI): 84866\nRRID: AB_2879507\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86YD3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869778432169,"sku":"24361-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24361-1-ap","provider":"Iright","version":"1.0","type":"link"}