{"product_id":"proteintech-24366-1-ap","title":"Proteintech, 24366-1-AP, GPATCH2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPATCH2 (24366-1-AP) by Proteintech is a Polyclonal antibody targeting GPATCH2 in WB, IHC, ELISA applications with reactivity to human,  mouse samples\n24366-1-AP targets GPATCH2 in WB, IHC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue,  mouse kidney tissue,  mouse thymus tissue\nPositive IHC detected in: human breast cancer tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21647 Product name: Recombinant human GPATCH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 290-376 aa of BC063474 Sequence: KESGGACGITGVVPWWEKEDPTELDKNVPDPVFESILTGSFPLMSHPSRRGFQARLSRLHGMSSKNIKKSGGTPTSMATNWTSEIPL Predict reactive species\nFull Name: G patch domain containing 2\nCalculated Molecular Weight: 528 aa, 59 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC063474\nGene Symbol: GPATCH2\nGene ID (NCBI): 55105\nRRID: AB_2879508\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NW75\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869688549545,"sku":"24366-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24366-1-ap","provider":"Iright","version":"1.0","type":"link"}