{"product_id":"proteintech-24379-1-ap","title":"Proteintech, 24379-1-AP, METTL13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe METTL13 (24379-1-AP) by Proteintech is a Polyclonal antibody targeting METTL13 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n24379-1-AP targets METTL13 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 5637 cells\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtein methyltransferase like 13 (METTL13), also called FEAT, is coded by gene METTL13, which is located at chromosome 1q24.3. Purified from rat livers in 2011 by a Japanese researcher, METTL13 was found to be abnormally overexpressed in several human cancers including lung cancer and to drive tumorigenesis in transgenic mice. A study indicated that METTL13 inhibits apoptosis of lung, breast and liver cancer cells and miR-16 can repress the expression of METTL13 by binding to its 3′-untranslated region. (PMID: 33985542)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19355 Product name: Recombinant human METTL13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 541-642 aa of BC029083 Sequence: QSDRMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRI Predict reactive species\nFull Name: methyltransferase like 13\nCalculated Molecular Weight: 699 aa, 79 kDa\nObserved Molecular Weight: 72-78 kDa\nGenBank Accession Number: BC029083\nGene Symbol: METTL13\nGene ID (NCBI): 51603\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N6R0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887717699753,"sku":"24379-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24379-1-ap","provider":"Iright","version":"1.0","type":"link"}