{"product_id":"proteintech-24382-1-ap","title":"Proteintech, 24382-1-AP, VSTM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VSTM1 (24382-1-AP) by Proteintech is a Polyclonal antibody targeting VSTM1 in WB, IHC, ELISA applications with reactivity to human samples\n24382-1-AP targets VSTM1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human peripheral blood leukocyte, HL-60 cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVSTM1 (V-set and transmembrane domain-containing protein 1) has two main splicing isoform, VSTM1-v1 and VSTM1-v2. VSTM1-v1 is a type I membrane molecule, mainly expressed on human peripheral blood granulocytes and monocytes. VSTM1-v2 is a classical secretory glycoprotein mainly expressed in immune tissues, and can promote the differentiation and activation of Th17 cells. (PMID: 22960280; 23909423)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15799 Product name: Recombinant human VSTM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-140 aa of BC100942 Sequence: CLGYEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTIFVAI Predict reactive species\nFull Name: V-set and transmembrane domain containing 1\nCalculated Molecular Weight: 236 aa, 26 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC100942\nGene Symbol: VSTM1\nGene ID (NCBI): 284415\nRRID: AB_2879516\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6UX27\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869792686249,"sku":"24382-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24382-1-ap","provider":"Iright","version":"1.0","type":"link"}