{"product_id":"proteintech-24437-1-ap","title":"Proteintech, 24437-1-AP, IRF8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IRF8 (24437-1-AP) by Proteintech is a Polyclonal antibody targeting IRF8 in WB, ELISA applications with reactivity to human samples\n24437-1-AP targets IRF8 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIRFs comprise a family of transcription factors that function within the Jak\/Stat pathway to regulate IFN and IFN-inducible gene expression in response to viral infection. IRFs predominantly express in lymphoid tissues and play an important role in pathogen defense, autoimmunity, lymphocyte development, cell growth, and susceptibility to transformation. The IRF family includes nine members: IRF-1, IRF-2, ISGF3γ\/p48, IRF-3, IRF-4 (Pip\/LSIRF\/ICSAT), IRF-5, IRF-6, IRF-7, and IRF-8\/ICSBP. All IRF proteins share homology in their amino-terminal DNA-binding domains. IRF family members regulate transcription through interactions with proteins that share similar DNA-binding motifs, such as IFN-stimulated response elements (ISRE), IFN consensus sequences (ICS), and IFN regulatory elements (IRF-E). IRF-8\/ICSCP is expressed predominately in hematopoietic cells and is further increased upon treatment with IFN (2111015,1460054). IRF-8 can function as a transcription repressor of ICS-containing promoters (1460054). Expression of IRF-8 can lead to the down-regulation of the anti-apoptotic protein Bcl-2 (14656881). Originally described as being induced by IFN-γ, IRF-8 expression is also elevated by IRF-α as well as IL-12 in NK and T cells (14581002). IRF-8 deficient mice have enhanced susceptibility to various pathogens and impaired production of IFNs, as well as deregulated hematopoiesis that resembles chronic myelogenous leukemia (9120398). IRF-8 also regulates bone metabolism by suppressing osteoclast formation (19718038).This antibody specifically recognizes the 48kd IRF8 protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19909 Product name: Recombinant human IRF8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 121-426 aa of BC126247 Sequence: KLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQQPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTKLYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPLRSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQITV Predict reactive species\nFull Name: ICSBP1\nCalculated Molecular Weight: 426 aa, 48 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC126247\nGene Symbol: IRF8\nGene ID (NCBI): 3394\nRRID: AB_2879549\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q02556\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887686602921,"sku":"24437-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24437-1-ap","provider":"Iright","version":"1.0","type":"link"}