{"product_id":"proteintech-24449-1-ap","title":"Proteintech, 24449-1-AP, CCBE1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCBE1 (24449-1-AP) by Proteintech is a Polyclonal antibody targeting CCBE1 in IHC, ELISA applications with reactivity to human samples\n24449-1-AP targets CCBE1 in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCBE1 (collagen and calcium-binding EGF domain-containing protein 1) is a secreted protein that is indispensible for lymphangiogenesis during development. CCBE1 may be a guidance molecule that regulates lymphangioblast budding and possibly migration (PMID: 19287381). The gene of CCBE1 maps to 18q21.32 and encodes a protein of 44 kDa that contains an EGF-like domain and two collagen-like domains. Mutations in the CCBE1 gene cause Hennekam lymphangiectasia-lymphedema syndrome (PMID: 19935664).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19686 Product name: Recombinant human CCBE1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-215 aa of BC046645 Sequence: MVKAGTCCATCKEFYQMKQTVLQLKQKIALLPNNAADLGKYITGDKVLASNTYLPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPGPRGSMGPMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFDFLLLMLADIRNDITELQEKVFGHRTHSSAEEFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRAPRDFYP Predict reactive species\nFull Name: collagen and calcium binding EGF domains 1\nCalculated Molecular Weight: 406 aa, 44 kDa\nGenBank Accession Number: BC046645\nGene Symbol: CCBE1\nGene ID (NCBI): 147372\nRRID: AB_2879553\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6UXH8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885873483945,"sku":"24449-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24449-1-ap","provider":"Iright","version":"1.0","type":"link"}