{"product_id":"proteintech-24533-1-ap","title":"Proteintech, 24533-1-AP, C13orf38 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C13orf38 (24533-1-AP) by Proteintech is a Polyclonal antibody targeting C13orf38 in WB, ELISA applications with reactivity to human, mouse samples\n24533-1-AP targets C13orf38 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCDC169 (coiled-coil structural domain protein 169) is a member of the human genome, also known as C13orf38, and belongs to the coiled-coil structural domain protein family. Members of this family are widely involved in cellular physiological functions, including DNA recognition, chromosome segregation, and protein interactions. CCDC169 is expressed in a variety of tissues, especially in the testis, suggesting that it may be associated with reproductive processes. In addition, CCDC169 is abnormally expressed in a variety of tumors, such as lung cancer and thyroid cancer, which may be related to tumorigenesis and development. Currently, research on CCDC169 is still in progress, and its specific mechanism of action in diseases has not been fully clarified.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21598 Product name: Recombinant human C13orf38 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-241 aa of BC146975 Sequence: MKEERNYNFDGVSTNRLKQQLLEEVRKKDAVQLSIFELRHKITELEAKLNTDNEGSEWKTRYETQLELNDELEKQIVYLKEKVEKIHGNSSDRLSSIRVYERMPVESLNTLLKQLEEEKKTLESQVKYYALKLEQESKAYQKINNERRTYLAEMSQGSGLHQVSKRQQVDQLPRMQENLVKTLLLKEELDPLKVSCLETLGFSAAGVAGPENRTCLGQKALWPACLHGSSTLAVCQTHLKS Predict reactive species\nFull Name: chromosome 13 open reading frame 38\nCalculated Molecular Weight: 241 aa, 28 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC146975\nGene Symbol: C13orf38\nGene ID (NCBI): 728591\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A6NNP5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885416206505,"sku":"24533-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24533-1-ap","provider":"Iright","version":"1.0","type":"link"}