{"product_id":"proteintech-24561-1-ap","title":"Proteintech, 24561-1-AP, ZW10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZW10 (24561-1-AP) by Proteintech is a Polyclonal antibody targeting ZW10 in WB, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n24561-1-AP targets ZW10 in WB, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HeLa cells,  mouse testis tissue,  K-562 cells,  rat liver tissue,  rat testis tissue\nPositive IP detected in: Jurkat cells\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZW10 is the human homolog of the Drosophila melanogaster Zw10 protein. ZW10 is localized to kinetochores and kinetochore-associated microtubules and is an essential component of the mitotic checkpoint, which prevents cells from prematurely exiting mitosis(PMID: 17102640). ZW10 proteins in Drosophila and HeLa cells display a similar and intriguing cell cycle-dependent intracellular distribution. ZW10 protein first becomes localized to the kinetochore at prometaphase, but then appears to move onto the kinetochore microtubules of the spindle at metaphase, and then back to the kinetochore at anaphase(PMID: 9700164).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19138 Product name: Recombinant human ZW10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 318-672 aa of BC128264 Sequence: NEKTSTVPLAEMLGDMIWEDLSECLIKNCLVYSIPTNSSKLQQYEEIIQSTEEFENALKEMRFLKGDTTDLLKYARNINSHFANKKCQDVIVAARNLMTSEIHNTVKIIPDSKINVPELPTPDEDNKLEVQKVSNTQYHEVMNLEPENTLDQHSFSLPTCRISESVKKLMELAYQTLLEATTSSDQCAVQLFYSVRNIFHLFHDVVPTYHKENLQKLPQLAAIHHNNCMYIAHHLLTLGHQFRLRLAPILCDGTATFVDLVPGFRRLGTECFLAQMRAQKGELLERLSSARNFSNMDDEENYSAASKAVRQVLHQLKRLGIVWQDVLPVNIYCKAMGTLLNTAISEVIGKITALE Predict reactive species\nFull Name: ZW10, kinetochore associated, homolog (Drosophila)\nCalculated Molecular Weight: 779 aa, 89 kDa\nObserved Molecular Weight: 88-90 kDa\nGenBank Accession Number: BC128264\nGene Symbol: ZW10\nGene ID (NCBI): 9183\nRRID: AB_2815001\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43264\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868962214057,"sku":"24561-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24561-1-ap","provider":"Iright","version":"1.0","type":"link"}