{"product_id":"proteintech-24571-1-ap","title":"Proteintech, 24571-1-AP, LRRC18 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LRRC18 (24571-1-AP) by Proteintech is a Polyclonal antibody targeting LRRC18 in WB, IP, IHC, ELISA applications with reactivity to human,  mouse samples\n24571-1-AP targets LRRC18 in WB, IP, IHC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLeucine rich repeat containing protein 18 ( LRRC18 ) encodes a 261 amino-acids protein (29.6 kDa), which contains 7 leucine rich repeat and belongs to LRR superfamily. The function of protein is still non-known, but it may be involved in the regulation of spermatogenesis and sperm maturation. The protein localizes in cytoplasm and express in some male reproduction tissues.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20996 Product name: Recombinant human LRRC18 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-261 aa of BC036722 Sequence: MVKGEKGPKGKKITLKVARNCIKITFDGKKRLDLSKMGITTFPKCILRLSDMDELDLSRNLIRKIPDSISKFQNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLTSNGLPVELKQLKNIRAVNLGLNHLDSVSTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFPKPGESEIFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNLISPNSMAKDSWEDWRIRLTSS Predict reactive species\nFull Name: leucine rich repeat containing 18\nCalculated Molecular Weight: 261 aa, 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC036722\nGene Symbol: LRRC18\nGene ID (NCBI): 474354\nRRID: AB_2879614\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N456\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887707639977,"sku":"24571-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24571-1-ap","provider":"Iright","version":"1.0","type":"link"}