{"product_id":"proteintech-24573-1-ap","title":"Proteintech, 24573-1-AP, NR2F1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NR2F1 (24573-1-AP) by Proteintech is a Polyclonal antibody targeting NR2F1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n24573-1-AP targets NR2F1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, PC-3 cells,  NIH\/3T3 cells\nPositive IHC detected in: human stomach cancer tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNR2F1 (Nuclear receptor subfamily 2, group F, member 1), also known as COUP-TFI, is an orphan nuclear receptor belonging to the superfamily of steroid\/thyroid hormone receptors and acting as a strong transcriptional regulator. NR2F1 has a DNA binding\ndomain (DBD) consisting of two conserved Zinc-finger motifs and a ligand-binding domain  (LBD). NR2F1 also plays an epigenetic role in mediating global histone modifications by interacting with or recruiting chromatin-remodeling enzymes. NR2F1 can be a biomarker of tumor dormancy that promotes quiescence of various types of cancer cells, including breast, prostate, and squamous cell carcinoma of the head and neck (PMID: 35740627).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0118 Product name: Recombinant human NR2F1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 178-421 aa of BC004154 Sequence: PLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQ Predict reactive species\nFull Name: nuclear receptor subfamily 2, group F, member 1\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: BC004154\nGene Symbol: NR2F1\nGene ID (NCBI): 7025\nRRID: AB_2879616\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10589\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868958544041,"sku":"24573-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24573-1-ap","provider":"Iright","version":"1.0","type":"link"}