{"product_id":"proteintech-24575-1-ap","title":"Proteintech, 24575-1-AP, PGRMC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PGRMC2 (24575-1-AP) by Proteintech is a Polyclonal antibody targeting PGRMC2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n24575-1-AP targets PGRMC2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  MCF-7 cells,  SKOV-3 cells,  human placenta tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMembrane-associated progesterone receptor component 2 (PGRMC2), also known as DG6 or PMBP, belongs to the cytochrome b5 family. The gene of PGRMC2 maps to chromosome 4q26, and encodes a 223-amino acid single-pass membrane protein with a cytochrome b5 heme-binding domain in its cytoplasmic domain. PGRMC2 is highly homologous to PGRMC1. PGRMC2 might play a role in cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20077 Product name: Recombinant human PGRMC2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 55-145 aa of BC016692 Sequence: LLNVALVALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGI Predict reactive species\nFull Name: progesterone receptor membrane component 2\nCalculated Molecular Weight: 223 aa, 24 kDa\nObserved Molecular Weight: 22 kDa, 28 kDa\nGenBank Accession Number: BC016692\nGene Symbol: PGRMC2\nGene ID (NCBI): 10424\nRRID: AB_3669443\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15173\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887758266537,"sku":"24575-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24575-1-ap","provider":"Iright","version":"1.0","type":"link"}