{"product_id":"proteintech-24578-1-ap","title":"Proteintech, 24578-1-AP, HEATR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HEATR2 (24578-1-AP) by Proteintech is a Polyclonal antibody targeting HEATR2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n24578-1-AP targets HEATR2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHEATR2 also termed as HEAT repeat containing 2 is an 855 amino acid protein. HEATR2 is a member of a family of ten other uncharacterized HEAT-repeat-containing proteins, which contains HEAT (Huntingtin, elongation factor 3 (EF3), protein phosphatase 2A (PP2A) and the yeast PI3-kinase Tor1) repeats. HEAT repeats form rod-like helical structures that are involved in intracellular transport. HEATR2 play an important role in dynein arm transportation or assembly.  HEATR2 mutation is implicated in Primary ciliary dyskinesia 18.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20080 Product name: Recombinant human HEATR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 661-809 aa of BC047240 Sequence: NLQWHAGRTAAAIRTAAVSCLWALTSSEVLSAEQIRDVQETLMPQVLTTLEEDSKMTRLISCRIINTFLKTSGGMTDPEKLIRIYPELLKRLDDVSNDVRMAAASTLVTWLQCVKGANAKSYYQSSVQYLYRELLVHLDDPERAIQDAI Predict reactive species\nFull Name: HEAT repeat containing 2\nCalculated Molecular Weight: 855 aa, 94 kDa\nObserved Molecular Weight: 93 kDa\nGenBank Accession Number: BC047240\nGene Symbol: HEATR2\nGene ID (NCBI): 54919\nRRID: AB_2827668\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86Y56\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869464645801,"sku":"24578-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24578-1-ap","provider":"Iright","version":"1.0","type":"link"}