{"product_id":"proteintech-24580-1-ap","title":"Proteintech, 24580-1-AP, KCNQ3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KCNQ3 (24580-1-AP) by Proteintech is a Polyclonal antibody targeting KCNQ3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n24580-1-AP targets KCNQ3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKCNQ3, also named as BFNC2, EBN2 and KV7.3, belongs to the potassium channel family and KQT subfamily. KCNQ3 is probably important in the regulation of neuronal excitability. Associates with KCNQ2 or KCNQ5, KCNQ3 forms a potassium channel with essentially identical properties to the channel underlying the native M-current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons as well as the responsiveness to synaptic inputs. Defects in KCNQ3 are the cause of benign neonatal epilepsy type 2 (EBN2).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20147 Product name: Recombinant human KCNQ3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 379-517 aa of BC128576 Sequence: PNRIDLVATWRFYESVVSFPFFRKEQLEAASSQKLGLLDRVRLSNPRGSNTKGKLFTPLNVDAIEESPSKEPKPVGLNNKERFRTAFRMKAYAFWQSSEDAGTGDPMAEDRGYGNDFPIEDMIPTLKAAIRAVRILQFR Predict reactive species\nFull Name: potassium voltage-gated channel, KQT-like subfamily, member 3\nCalculated Molecular Weight: 872 aa, 97 kDa\nObserved Molecular Weight: ~90 kDa\nGenBank Accession Number: BC128576\nGene Symbol: KCNQ3\nGene ID (NCBI): 3786\nRRID: AB_3085739\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43525\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887692107945,"sku":"24580-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24580-1-ap","provider":"Iright","version":"1.0","type":"link"}