{"product_id":"proteintech-24585-1-ap","title":"Proteintech, 24585-1-AP, TEX15 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TEX15 (24585-1-AP) by Proteintech is a Polyclonal antibody targeting TEX15 in WB, IP, IHC, ELISA applications with reactivity to human,  mouse,  rat samples\n24585-1-AP targets TEX15 in WB, IP, IHC, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat testis tissue\nPositive IP detected in: PC-3 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTEX15 also named as Cancer\/testis antigen 42 is a 2789 amino acid protein, which is expressed exclusively in testicular and cancerous tissues and may be involved in the development and metastasis of several different types of tumors. TEX15 exists as a 1279 amino acid protein in the mouse and rat testis. The molecular weight of mouse\/rat TEX15 is 150 kDa (PMID: 26959739).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20170 Product name: Recombinant human TEX15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC141841 Sequence: MPSDAKDSVNGDLLLNWTSLKNILSGLNASFPLHNNTGSSTVTTSKSIKDPRLMRREESMGEQSSTAGLNEVLQFEKSSDNVNSEIKSTPSNSASSS Predict reactive species\nFull Name: testis expressed 15\nCalculated Molecular Weight: 2789 aa, 315 kDa\nObserved Molecular Weight: 150 kDa\nGenBank Accession Number: BC141841\nGene Symbol: TEX15\nGene ID (NCBI): 56154\nRRID: AB_2879623\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BXT5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869612331177,"sku":"24585-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24585-1-ap","provider":"Iright","version":"1.0","type":"link"}